PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 27647.m000179
Common NameLOC8270676, RCOM_0053570
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family ARR-B
Protein Properties Length: 669aa    MW: 72635.7 Da    PI: 6.6078
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
27647.m000179genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.53e-28229282155
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    kpr++W+ eLH++Fv+av+qL G++kA+Pk+ilelm+v+gLt+e+v+SHLQk+Rl
  27647.m000179 229 KPRVVWSVELHQQFVSAVNQL-GIDKAVPKRILELMNVPGLTRENVASHLQKFRL 282
                    79*******************.********************************8 PP

2Response_reg78.13.1e-26451531109
                    EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTE CS
   Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGa 94 
                    vl+vdD+ + +++l+q+l++  y +v+++++++ al+ll+e++  +D++l D+ mp+mdG++ll++   e  +lp+i+++a g  + + + ++ Ga
  27647.m000179  45 VLVVDDDTTCLRILEQMLRRCLY-HVTTCSQAKVALNLLRERKgcFDVVLSDVHMPDMDGFKLLEHVGLEM-DLPVIMMSADGRTSAVMRGIRHGA 138
                    89*********************.*******************************************6644.8*********************** PP

                    SEEEESS--HHHHHH CS
   Response_reg  95 kdflsKpfdpeelvk 109
                     d+l Kp+ +eel +
  27647.m000179 139 CDYLIKPIREEELKN 153
                    ************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23002.6E-4342180No hitNo description
SuperFamilySSF521723.42E-3642172IPR011006CheY-like superfamily
SMARTSM004481.1E-3043155IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.65644159IPR001789Signal transduction response regulator, receiver domain
PfamPF000722.9E-2345153IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.44E-2746158No hitNo description
PROSITE profilePS5129411.209226285IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.3E-30226287IPR009057Homeodomain-like
SuperFamilySSF466891.4E-19226286IPR009057Homeodomain-like
TIGRFAMsTIGR015572.5E-24229282IPR006447Myb domain, plants
PfamPF002499.7E-7231280IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016310Biological Processphosphorylation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0016301Molecular Functionkinase activity
Sequence ? help Back to Top
Protein Sequence    Length: 669 aa     Download sequence    Send to blast
MAALQRVASS VSATASNYSS CKGNGVVTAT ADVAVSDQFP AGLRVLVVDD DTTCLRILEQ  60
MLRRCLYHVT TCSQAKVALN LLRERKGCFD VVLSDVHMPD MDGFKLLEHV GLEMDLPVIM  120
MSADGRTSAV MRGIRHGACD YLIKPIREEE LKNIWQHVVR KKWHENKEIE HSGSLEDNDR  180
HKRGNEDAEY TSSVNEGTEG VLKGQKRRSN SKDEDDGEPD SDDPSTSKKP RVVWSVELHQ  240
QFVSAVNQLG IDKAVPKRIL ELMNVPGLTR ENVASHLQKF RLYLKRLSGV AQQGGISSTF  300
CGPMDSNVKL NSLGRFDIQA LAASGQIPPQ TLAALHAELF GRPTGSLVTT MDQPTLLQAS  360
RQSPKCIPVE HGVTFGQPIV KCSSGISKHF PQNMVSVEEV SSGYGAWPSN SLGTVGPSTN  420
LGGMTTQNGN MLMDIFHQQQ KQQQPQQQQS LADPSRSINV QPSCLVVPSQ SSACFQAGNS  480
PASVNQSNFN RNVVIDYSLL SSQSNNSALN IGHIPEGDLK TTGAVNGYSA PGSLSPPASS  540
CSVNADSGVP RQVQNPTLAF GAVRQLPALS PNIFNIQGSY GVRSDDILDQ GPFFKNLGFV  600
GKGTCIPSRF AVDEFETPSS NLSHGKLYVE NNDNKVKQEP NIDFTDTSRV GIPVLQQYPP  660
NDLMSVFTE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-23225288164ARR10-B
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1201207LKGQKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002533196.10.0PREDICTED: two-component response regulator ORR21 isoform X1
SwissprotA2XE311e-170ORR21_ORYSI; Two-component response regulator ORR21
TrEMBLB9T4M70.0B9T4M7_RICCO; Two-component sensor histidine kinase bacteria, putative
STRINGPOPTR_0010s11600.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF118082433
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.11e-122response regulator 2